Vibeleaderboard
Index / tool

Claude Life Sciences Marketplace

https://github.com/anthropics/life-sciences
Visit github.com
Category
AI Agents
Rank
No. 1032Tools index
Pricing
Open Source
Type
TOOL
Builder
anthropics
GitHub
592 stars
Latest release
v1.1.1
Date

About

Claude Code marketplace for life sciences MCP servers. Bioinformatics tools, lab integrations, dataset connectors.

What it does

A Claude Code add-on collection that brings scientific services and guided analysis workflows into one working environment. Researchers can search literature, reach provider platforms, run single-cell quality control, train several scvi-tools models, integrate datasets, transfer labels, and execute selected nf-core pipelines.

Why it's ranked here

The collection is unusually practical because it pairs service connections with executable analysis workflows. The strongest evidence is its single-cell tooling: validation, configurable filtering, model training, clustering, integration, label transfer, plots, and saved results form a coherent path. Its value still depends heavily on external accounts and local scientific software.

What's good

The single-cell workflows expose meaningful controls instead of hiding scientific choices. Users can tune quality thresholds, highly variable gene selection, latent dimensions, training epochs, clustering resolution, and prediction confidence. Validation checks raw counts, missing metadata, invalid values, sparsity, batch sizes, rare labels, and gene selection before expensive training begins.

Tradeoffs

Most service connections require authentication, and some require paid or institutional access. The 10x Genomics connection only helps users who already have cloud analysis data. Nextflow workflows require Docker and Nextflow locally. Provider support remains separate, and tenant-specific service URLs are unsupported, which caused the Benchling integration to be removed.

How to use it well

It suits life scientists already working in Claude Code who want literature access and repeatable omics workflows close to their research conversation. Start with one narrowly relevant plugin, validate inputs, inspect generated plots, and retain explicit parameters for reproducibility. Treat the single-cell quality-control workflow as preprocessing, not a complete cleanup suite: ambient RNA correction and doublet detection remain separate next steps.

Technical notes+

README.md defines Claude Code marketplace installation, per-plugin authentication, remote MCP servers, one local MCPB server, and skill packages. scvi-tools/scripts/prepare_data.py prepares AnnData counts and highly variable genes; scvi-tools/scripts/train_model.py dispatches scVI, scANVI, totalVI, PeakVI, veloVI, and MultiVI training; scvi-tools/scripts/cluster_embed.py adds neighbors, UMAP, and Leiden results; scvi-tools/scripts/validate_adata.py returns ValidationResult diagnostics; scvi-tools/scripts/transfer_labels.py maps query cells through a reference SCANVI model; and scvi-tools/scripts/integrate_datasets.py joins common genes before batch-aware training. single-cell-rna-qc/scripts/qc_analysis.py composes qc_core.py and qc_plotting.py into a CLI workflow that writes annotated AnnData files and PNG diagnostics.

Observed

Install surface
Claude Code marketplace commands install individual MCP servers and skills.
Interfaces
Remote MCP, local MCPB, Claude Code skills, and Python command-line scripts.
Authentication
PubMed requires none; other listed services require free, paid, or institutional accounts.
Platform requirements
The Nextflow workflow requires Docker and Nextflow installed locally.
Implementation language
The supplied analysis and quality-control scripts are Python.
License
Individual MCP servers use their providers' licenses and terms of service.

Read from README.md, scvi-tools/scripts/model_utils.py, scvi-tools/scripts/train_model.py, scvi-tools/scripts/prepare_data.py, scvi-tools/scripts/cluster_embed.py, scvi-tools/scripts/validate_adata.py, scvi-tools/scripts/transfer_labels.py, single-cell-rna-qc/scripts/qc_core.py, scvi-tools/scripts/integrate_datasets.py, single-cell-rna-qc/scripts/qc_analysis.py, single-cell-rna-qc/scripts/qc_plotting.py.

What it can do

  • Connect to bioinformatics databases

    Database query parameters and credentialsBiological data from public/private databases

  • Integrate with laboratory equipment

    Lab equipment APIs and protocolsReal-time instrument data and control commands

  • Process genomic datasets

    Raw genomic data files (FASTA, FASTQ, VCF)Analyzed genomic data and visualizations

  • Generate bioinformatics analysis code

    Natural language description of analysis workflowExecutable Python/R code for biological data analysis

  • Access molecular structure databases

    Compound identifiers or structure queries3D molecular structures and chemical properties

  • Deploy custom MCP servers

    Server configuration and bioinformatics tool specificationsRunning MCP server instances for lab workflows

Tags

claude-codemcplife-sciencesmarketplacepython

Tech Stack

Python

Comments (0)

No comments yet

Editorially curated, with community endorsements as a secondary signal. Corrections welcome.